PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG034391t1
Common NameTCM_034391
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family Nin-like
Protein Properties Length: 953aa    MW: 105470 Da    PI: 6.7991
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG034391t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.81e-28634685152
            RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       aek+i+l++l+++F++++kdAAk++gvc+T+LKriCRq+GIkRWP+Rkik++
  Thecc1EG034391t1 634 AEKTITLQVLRQHFAGSLKDAAKSIGVCPTTLKRICRQHGIKRWPSRKIKKV 685
                       589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.564624705IPR003035RWP-RK domain
PfamPF020422.6E-25637685IPR003035RWP-RK domain
SuperFamilySSF542772.52E-22854941No hitNo description
SMARTSM006663.9E-27855938IPR000270PB1 domain
PROSITE profilePS5174527.62855938IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2407.1E-22856935No hitNo description
PfamPF005641.4E-19857937IPR000270PB1 domain
CDDcd064078.86E-40857936No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 953 aa     Download sequence    Send to blast
MRSVFVAHVL VPASDYLLKT GIHPRSAILG GPSYSAMDFD YMDELFLDGC WLETAEGSEF  60
LTLSPSSSNA FFDPAFMWPT SESNTGDLGA GLSQIHNQGE NQRSLLPGNS HMNGTQAESL  120
VSPQFSHMAD VDKSHSPHGY CITEGSELSK RWWIGPRTSP GPATSVMQRL IQALDYIKDF  180
AKEKDVLVQL WVPVNRGGRR VLTTSEQPFS LDPNSQRLAS YRNISVKYQF PAEEDSKDAA  240
GLPGRVFLSK VPEWTPDVRF FRSDEYPRLG HAQQHDVRGT FALPVFEQGS RTCLGVIEVV  300
MTTEKIKIRP ELESVCKALE AVNLRSSIAS STQNVKACNK SYQAGLHEIK EVLRCACDTH  360
GLPLAQTWVS CIEQGKEGCR HSTDNYVHCV STVDDACHIG DPNILGFHEA CSEHHLLKGQ  420
GVAGRAFMTN QPCFSADITS FKRTEYPLAH HAMMFNLHAA VSIRLRCIHT GNADFVLEFF  480
LPTDCRDPEG QKKMLNSLSI IIQQVCCSLR VVTDKELDEE TDLALSEVIA PSDGIPSRDQ  540
LSKEQCTHRS QKRSSENSSW TASLTEVQQS TNAALGLGKE KPRAMLDEEL SELKQHHEQV  600
GLRESVECGD STFNEISFTS LAMGKTGEKR RTKAEKTITL QVLRQHFAGS LKDAAKSIGV  660
CPTTLKRICR QHGIKRWPSR KIKKVGHSLQ KLQNVIDSVQ GASGAFHISS FYSNFPELAS  720
PKLSGTSTLS TTRLNDQPKQ TSIQPEGDNF LPQAATSNSP SSSCSQSSSS SQCYSSGTHQ  780
PSKISGNEDL TIGESSGDCE LKRVRSDAEL HAVSKEGPKL FPRSQSLRSL NEQLISDSLQ  840
PISKNTSQIA QDLDAQRIKV TYGDEKIRLR MKNKWLFKDL LHEITRRFNI DDISRFDLKY  900
LDDDSEWVLL TCDADLKECI DVCQSSQGNT IKLSLQVSHH HLDRSSGSTG PL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007018035.10.0Plant regulator RWP-RK family protein, putative
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA0A061FD780.0A0A061FD78_THECC; Plant regulator RWP-RK family protein, putative
STRINGPOPTR_0005s27310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]